Annotated protein: | Neurexin-1-beta (Neurexin I-beta). Gene symbol: NRXN1. Taxonomy: Mus musculus (Mouse). Uniprot ID: P0DI97 |
antibody wiki: | |
SynGO gene info: | SynGO data @ NRXN1 |
Ontology domain: | Biological Process |
SynGO term: | regulation of postsynaptic density assembly (GO:0099151) |
Synapse type(s): | cerebellum, glutamatergic |
Annotated paper: | Matsuda K, et al. "Cbln family proteins promote synapse formation by regulating distinct neurexin signaling pathways in various brain regions" Eur J Neurosci. 2011 Apr;33(8):1447-61 PMID:21410790 |
Figure(s): | Fig. 5 |
Annotation description: | Fig.5: "NRX1β(S4+) functions as a postsynaptic organizer by forming a tripartite complex with Cbln1 and GluD2." NRX1β(S4+)-conjugated beads induced clustering of endogenous GluD2 (green) and its associated postsynaptic protein shank2 (red) in cbln1-null Purkinje cells only in the presence of HA-Cbln1 20/11/2017 Pim - The isoform of Nrx1beta was traced back to xxxx via PMID:16624946 using aa sequence 'GNND-NERLAIARQRIPYRLGRVVDEWLLDK' in blast search. This resulted 100% hits against reviewed Neurexin-1-beta sequences in rat (Q63373), mouse (P0DI97) and human (P58400). |
Evidence tracking, Biological System: | Cultured neurons |
Evidence tracking, Protein Targeting: | Over-expression |
Evidence tracking, Experiment Assay: | Confocal |
Annotator(s): | Daniela Dieterich (ORCID:0000-0002-9880-1214) Rainer Pielot (ORCID:0000-0002-9681-3318) Karl-Heinz Smalla (ORCID:0000-0002-0269-0311) Eckart Gundelfinger (ORCID:0000-0001-9377-7414) |
Lab: | Leibniz Institute for Neurobiology (LIN), Institute of Pharmacology and Toxicology, Otto von Guericke University, Center for Behavioral Brain Sciences (CBBS), Magdeburg, Germany |
SynGO annotation ID: | 1935 |
Dataset release (version): | 20231201 |
View annotation as GO-CAM model: | ![]() |